PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa018546
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family G2-like
Protein Properties Length: 377aa    MW: 42819.3 Da    PI: 9.2482
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58690124PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.84.2e-32203256255
    G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Lsa018546 203 PRMRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLSHVKSHLQMYRT 256
                9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.97E-15200256IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.9E-28201256IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-23203256IPR006447Myb domain, plants
PfamPF002492.3E-7204255IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MELFPAQPDL SLQISPPTSK PTSKAWRTSS TASDQDHHDL DLGNLWKRAF NSQQLHQQQQ  60
QQQQHGSTRR PEPSFGLSLS NPNIHSTNSD LTHFHNLLST QNTNTSSSSN MYPYQHHQHH  120
HQAGFSSELG FLRPIRGIPV YYQNTPPNFP IMANPHHKNQ PSLDSCTNST TTSSLIHSNN  180
INNIVRSRFL SSRFPSKRSM RAPRMRWTTT LHARFVHAVE LLGGHERATP KSVLELMDVK  240
DLTLSHVKSH LQMYRTVKTT DRAPVSSGQS DIYENGSSGD NSDDIMFDIR NPRPTDQLST  300
EHGGRSSVHQ EKDCQYGLWS NSSREAWLHG EHRDSEGNKL YLEKDMNLKG PHYERLSEVS  360
SSSPKKPNLE FTLGRPH
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010663135.11e-128PREDICTED: probable transcription factor KAN2 isoform X2
SwissprotQ9C6164e-89KAN2_ARATH; Probable transcription factor KAN2
TrEMBLA0A103XQV41e-166A0A103XQV4_CYNCS; Homeodomain-like protein (Fragment)
STRINGVIT_02s0012g01940.t011e-127(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.11e-69G2-like family protein